Domain Type No. Of PIs No. of DS Bonds No. of Species
H-L Type (Type-I) 1 2 1
Sequence
Reactive Loop      Linker
AVQAVRVATNYSADGTFICEGESDPNNPKACPRNCDQILPIHCVS
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-1 CPRNC 31 - 35 Trypsin
Linkers
Entry Linker Position Type
L-5 DPNNP 24 - 28 Type-I(DPRNP)
Disulphide Bonds
Bond No. Position
Bond 1 19 - 43
Bond 2 31 - 35
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45
A V Q A V R V A T N Y S A D G T F I C E G E S D P N N P K A C P R N C D Q I L P I H C V S


Amino Acid Count Percentage
Alanine 5 11.11111111
Cysteine 4 8.888888889
Aspartic acid 3 6.666666667
Glutamic acid 2 4.444444444
Phenylalanine 1 2.222222222
Glycine 2 4.444444444
Histidine 1 2.222222222
Isoleucine 3 6.666666667
Lysine 1 2.222222222
Leucine 1 2.222222222
Methionine 0 0
Asparagine 4 8.888888889
Proline 4 8.888888889
Glutamine 2 4.444444444
Arginine 2 4.444444444
Serine 3 6.666666667
Threonine 2 4.444444444
Valine 4 8.888888889
Tryptophan 0 0
Tyrosine 1 2.222222222