Domain Type No. Of PIs No. of DS Bonds No. of Species
H-L Type (Type-I) 1 0 1
Sequence
Reactive Loop      Linker
EVLTNNMYGAFPLPYFSDDGTFVCEGESDPRNPKACPRNCDPRIAYG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-1 CPRNC 36 - 40 Trypsin
Linkers
Entry Linker Position Type
L-1 DPRNP 29 - 33 Type-I(DPRNP)
Disulphide Bonds
Bond No. Position
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47
E V L T N N M Y G A F P L P Y F S D D G T F V C E G E S D P R N P K A C P R N C D P R I A Y G


Amino Acid Count Percentage
Alanine 3 6.382978723
Cysteine 3 6.382978723
Aspartic acid 4 8.510638298
Glutamic acid 3 6.382978723
Phenylalanine 3 6.382978723
Glycine 4 8.510638298
Histidine 0 0
Isoleucine 1 2.127659574
Lysine 1 2.127659574
Leucine 2 4.255319149
Methionine 1 2.127659574
Asparagine 4 8.510638298
Proline 6 12.76595745
Glutamine 0 0
Arginine 3 6.382978723
Serine 2 4.255319149
Threonine 2 4.255319149
Valine 2 4.255319149
Tryptophan 0 0
Tyrosine 3 6.382978723