Domain Type No. Of PIs No. of DS Bonds No. of Species
H-L Type (Type-I) 1 4 1
Sequence
Reactive Loop      Linker
RLCTNCCAGMKGCNYFSADGTFVCEGESDPRNPKPCPRNCDGRIAYGICPLS
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-1 CPRNC 36 - 40 Trypsin
Linkers
Entry Linker Position Type
L-1 DPRNP 29 - 33 Type-I(DPRNP)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 40
Bond 2 6 - 24
Bond 3 7 - 36
Bond 4 13 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R L C T N C C A G M K G C N Y F S A D G T F V C E G E S D P R N P K P C P R N C D G R I A Y G I C P L S


Amino Acid Count Percentage
Alanine 3 5.769230769
Cysteine 8 15.38461538
Aspartic acid 3 5.769230769
Glutamic acid 2 3.846153846
Phenylalanine 2 3.846153846
Glycine 6 11.53846154
Histidine 0 0
Isoleucine 2 3.846153846
Lysine 2 3.846153846
Leucine 2 3.846153846
Methionine 1 1.923076923
Asparagine 4 7.692307692
Proline 5 9.615384615
Glutamine 0 0
Arginine 4 7.692307692
Serine 3 5.769230769
Threonine 2 3.846153846
Valine 1 1.923076923
Tryptophan 0 0
Tyrosine 2 3.846153846