Domain Type No. Of PIs No. of DS Bonds No. of Species
H-L Type (Type-I) 1 2 1
Sequence
Reactive Loop      Linker
AVAFSINSKYYRADGTFICEGESDPKNPKGCPRNCDPRIAYSKCPRS
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-1 CPRNC 31 - 35 Trypsin
Linkers
Entry Linker Position Type
L-3 DPKNP 24 - 28 Type-I(DPRNP)
Disulphide Bonds
Bond No. Position
Bond 1 19 - 44
Bond 2 31 - 35
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47
A V A F S I N S K Y Y R A D G T F I C E G E S D P K N P K G C P R N C D P R I A Y S K C P R S


Amino Acid Count Percentage
Alanine 4 8.510638298
Cysteine 4 8.510638298
Aspartic acid 3 6.382978723
Glutamic acid 2 4.255319149
Phenylalanine 2 4.255319149
Glycine 3 6.382978723
Histidine 0 0
Isoleucine 3 6.382978723
Lysine 4 8.510638298
Leucine 0 0
Methionine 0 0
Asparagine 3 6.382978723
Proline 5 10.63829787
Glutamine 0 0
Arginine 4 8.510638298
Serine 5 10.63829787
Threonine 1 2.127659574
Valine 1 2.127659574
Tryptophan 0 0
Tyrosine 3 6.382978723