Domain Type No. Of PIs No. of DS Bonds No. of Species
H-L Type (Type-I) 1 4 1
Sequence
Reactive Loop      Linker
RICTNCCAGYKGCNYYSANGAFICEGESDPKNPNVCPRNCDTNIAYSKCPRS
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-1 CPRNC 36 - 40 Trypsin
Linkers
Entry Linker Position Type
L-3 DPKNP 29 - 33 Type-I(DPRNP)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 40
Bond 2 6 - 24
Bond 3 7 - 36
Bond 4 13 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
R I C T N C C A G Y K G C N Y Y S A N G A F I C E G E S D P K N P N V C P R N C D T N I A Y S K C P R S


Amino Acid Count Percentage
Alanine 4 7.692307692
Cysteine 8 15.38461538
Aspartic acid 2 3.846153846
Glutamic acid 2 3.846153846
Phenylalanine 1 1.923076923
Glycine 4 7.692307692
Histidine 0 0
Isoleucine 3 5.769230769
Lysine 3 5.769230769
Leucine 0 0
Methionine 0 0
Asparagine 7 13.46153846
Proline 4 7.692307692
Glutamine 0 0
Arginine 3 5.769230769
Serine 4 7.692307692
Threonine 2 3.846153846
Valine 1 1.923076923
Tryptophan 0 0
Tyrosine 4 7.692307692