Domain Type No. Of PIs No. of DS Bonds No. of Species
H-L Type (Type-I) 1 3 1
Sequence
Reactive Loop      Linker
PICTNCCSGYKGCNYYYANGTFICEGTSDPKNPNICPSYCDPQIAYS
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-46 CPSYC 36 - 40 Unknown
Linkers
Entry Linker Position Type
L-3 DPKNP 29 - 33 Type-I(DPRNP)
Disulphide Bonds
Bond No. Position
Bond 1 6 - 24
Bond 2 7 - 13
Bond 3 36 - 40
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47
P I C T N C C S G Y K G C N Y Y Y A N G T F I C E G T S D P K N P N I C P S Y C D P Q I A Y S


Amino Acid Count Percentage
Alanine 2 4.255319149
Cysteine 7 14.89361702
Aspartic acid 2 4.255319149
Glutamic acid 1 2.127659574
Phenylalanine 1 2.127659574
Glycine 4 8.510638298
Histidine 0 0
Isoleucine 4 8.510638298
Lysine 2 4.255319149
Leucine 0 0
Methionine 0 0
Asparagine 5 10.63829787
Proline 5 10.63829787
Glutamine 1 2.127659574
Arginine 0 0
Serine 4 8.510638298
Threonine 3 6.382978723
Valine 0 0
Tryptophan 0 0
Tyrosine 6 12.76595745