Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
RVCTQECDPRVAYMTCPSTGSTKHTRICVNCCTAKSGCKLYDRNGSQLCTG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-18 CTQEC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 32
Bond 2 7 - 38
Bond 3 16 - 28
Bond 4 31 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
R V C T Q E C D P R V A Y M T C P S T G S T K H T R I C V N C C T A K S G C K L Y D R N G S Q L C T G


Amino Acid Count Percentage
Alanine 2 3.921568627
Cysteine 8 15.68627451
Aspartic acid 2 3.921568627
Glutamic acid 1 1.960784314
Phenylalanine 0 0
Glycine 4 7.843137255
Histidine 1 1.960784314
Isoleucine 1 1.960784314
Lysine 3 5.882352941
Leucine 2 3.921568627
Methionine 1 1.960784314
Asparagine 2 3.921568627
Proline 2 3.921568627
Glutamine 2 3.921568627
Arginine 4 7.843137255
Serine 4 7.843137255
Threonine 7 13.7254902
Valine 3 5.882352941
Tryptophan 0 0
Tyrosine 2 3.921568627