Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
QICTQECNPNAAYMICQPNNKKTKNVCTNCCKIQNTRCHIYTSKDGLIC
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-18 CTQEC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 30
Bond 2 7 - 31
Bond 3 16 - 38
Bond 4 27 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49
Q I C T Q E C N P N A A Y M I C Q P N N K K T K N V C T N C C K I Q N T R C H I Y T S K D G L I C


Amino Acid Count Percentage
Alanine 2 4.081632653
Cysteine 8 16.32653061
Aspartic acid 1 2.040816327
Glutamic acid 1 2.040816327
Phenylalanine 0 0
Glycine 1 2.040816327
Histidine 1 2.040816327
Isoleucine 5 10.20408163
Lysine 5 10.20408163
Leucine 1 2.040816327
Methionine 1 2.040816327
Asparagine 7 14.28571429
Proline 2 4.081632653
Glutamine 4 8.163265306
Arginine 1 2.040816327
Serine 1 2.040816327
Threonine 5 10.20408163
Valine 1 2.040816327
Tryptophan 0 0
Tyrosine 2 4.081632653