Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 2 4 1
Sequence
Reactive Loop      Linker
KVCTQQCDPKVAYMTCPPESTKLTRVCVNCCTAKPGCKLYGHDGSLICIG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-20 CTQQC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 31
Bond 2 7 - 37
Bond 3 16 - 27
Bond 4 30 - 48
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K V C T Q Q C D P K V A Y M T C P P E S T K L T R V C V N C C T A K P G C K L Y G H D G S L I C I G


Amino Acid Count Percentage
Alanine 2 4
Cysteine 8 16
Aspartic acid 2 4
Glutamic acid 1 2
Phenylalanine 0 0
Glycine 4 8
Histidine 1 2
Isoleucine 2 4
Lysine 5 10
Leucine 3 6
Methionine 1 2
Asparagine 1 2
Proline 4 8
Glutamine 2 4
Arginine 1 2
Serine 2 4
Threonine 5 10
Valine 4 8
Tryptophan 0 0
Tyrosine 2 4