Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
KGCSRNCDTEVDYMVCPSGGETITRNVCTNCCSAQKSCKLFRSDGSVKCSG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-22 CSRNC 3 - 7 Trypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 28
Bond 2 7 - 32
Bond 3 16 - 38
Bond 4 31 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K G C S R N C D T E V D Y M V C P S G G E T I T R N V C T N C C S A Q K S C K L F R S D G S V K C S G


Amino Acid Count Percentage
Alanine 1 1.960784314
Cysteine 8 15.68627451
Aspartic acid 3 5.882352941
Glutamic acid 2 3.921568627
Phenylalanine 1 1.960784314
Glycine 5 9.803921569
Histidine 0 0
Isoleucine 1 1.960784314
Lysine 4 7.843137255
Leucine 1 1.960784314
Methionine 1 1.960784314
Asparagine 3 5.882352941
Proline 1 1.960784314
Glutamine 1 1.960784314
Arginine 3 5.882352941
Serine 7 13.7254902
Threonine 4 7.843137255
Valine 4 7.843137255
Tryptophan 0 0
Tyrosine 1 1.960784314