Domain Type No. Of PIs No. of DS Bonds No. of Species
L-H Type (Type-II) 3 4 2
Sequence
Reactive Loop      Linker
KSCTTECDPRVATISCPFSGLVKINQECINCCNADKGCELYDNDGSLICTG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-24 CTTEC 3 - 7 Unknown
Linkers
Entry Linker Position Type
L-55 GLVKI 20 - 24 Type-II(EEKKN)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 32
Bond 2 7 - 38
Bond 3 16 - 28
Bond 4 31 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K S C T T E C D P R V A T I S C P F S G L V K I N Q E C I N C C N A D K G C E L Y D N D G S L I C T G


Amino Acid Count Percentage
Alanine 2 3.921568627
Cysteine 8 15.68627451
Aspartic acid 4 7.843137255
Glutamic acid 3 5.882352941
Phenylalanine 1 1.960784314
Glycine 4 7.843137255
Histidine 0 0
Isoleucine 4 7.843137255
Lysine 3 5.882352941
Leucine 3 5.882352941
Methionine 0 0
Asparagine 4 7.843137255
Proline 2 3.921568627
Glutamine 1 1.960784314
Arginine 1 1.960784314
Serine 4 7.843137255
Threonine 4 7.843137255
Valine 2 3.921568627
Tryptophan 0 0
Tyrosine 1 1.960784314