Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
KVCPLYCIINQGIYMTCPSSGSQKLEPVCNCCLAKTGCKLYRDNGTLICTA
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-27 CPLYC 3 - 7 Chymotrypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 29
Bond 2 7 - 32
Bond 3 17 - 38
Bond 4 31 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K V C P L Y C I I N Q G I Y M T C P S S G S Q K L E P V C N C C L A K T G C K L Y R D N G T L I C T A


Amino Acid Count Percentage
Alanine 2 3.921568627
Cysteine 8 15.68627451
Aspartic acid 1 1.960784314
Glutamic acid 1 1.960784314
Phenylalanine 0 0
Glycine 4 7.843137255
Histidine 0 0
Isoleucine 4 7.843137255
Lysine 4 7.843137255
Leucine 5 9.803921569
Methionine 1 1.960784314
Asparagine 3 5.882352941
Proline 3 5.882352941
Glutamine 2 3.921568627
Arginine 1 1.960784314
Serine 3 5.882352941
Threonine 4 7.843137255
Valine 2 3.921568627
Tryptophan 0 0
Tyrosine 3 5.882352941