Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
KACPLYCLDVDYMTCESSGDKKLNSACNCCLAPKNCTLHLADGRMVQC
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-27 CPLYC 3 - 7 Chymotrypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 30
Bond 2 7 - 36
Bond 3 15 - 48
Bond 4 27 - 29
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48
K A C P L Y C L D V D Y M T C E S S G D K K L N S A C N C C L A P K N C T L H L A D G R M V Q C


Amino Acid Count Percentage
Alanine 4 8.333333333
Cysteine 8 16.66666667
Aspartic acid 4 8.333333333
Glutamic acid 1 2.083333333
Phenylalanine 0 0
Glycine 2 4.166666667
Histidine 1 2.083333333
Isoleucine 0 0
Lysine 4 8.333333333
Leucine 6 12.5
Methionine 2 4.166666667
Asparagine 3 6.25
Proline 2 4.166666667
Glutamine 1 2.083333333
Arginine 1 2.083333333
Serine 3 6.25
Threonine 2 4.166666667
Valine 2 4.166666667
Tryptophan 0 0
Tyrosine 2 4.166666667