Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
IVCPLYCLDVDYMTCPSSGEEKLSPSCNCCLAPKNCTLHLSDGSSIYCK
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-27 CPLYC 3 - 7 Chymotrypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 27
Bond 2 7 - 29
Bond 3 15 - 48
Bond 4 30 - 36
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49
I V C P L Y C L D V D Y M T C P S S G E E K L S P S C N C C L A P K N C T L H L S D G S S I Y C K


Amino Acid Count Percentage
Alanine 1 2.040816327
Cysteine 8 16.32653061
Aspartic acid 3 6.12244898
Glutamic acid 2 4.081632653
Phenylalanine 0 0
Glycine 2 4.081632653
Histidine 1 2.040816327
Isoleucine 2 4.081632653
Lysine 3 6.12244898
Leucine 6 12.24489796
Methionine 1 2.040816327
Asparagine 2 4.081632653
Proline 4 8.163265306
Glutamine 0 0
Arginine 0 0
Serine 7 14.28571429
Threonine 2 4.081632653
Valine 2 4.081632653
Tryptophan 0 0
Tyrosine 3 6.12244898