Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
KACPLYCLDVEYMTCQSSGEKKLNPSCNCCLAPKNCTVHLVDGTSIYCKG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-27 CPLYC 3 - 7 Chymotrypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 27
Bond 2 7 - 30
Bond 3 15 - 36
Bond 4 29 - 48
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K A C P L Y C L D V E Y M T C Q S S G E K K L N P S C N C C L A P K N C T V H L V D G T S I Y C K G


Amino Acid Count Percentage
Alanine 2 4
Cysteine 8 16
Aspartic acid 2 4
Glutamic acid 2 4
Phenylalanine 0 0
Glycine 3 6
Histidine 1 2
Isoleucine 1 2
Lysine 5 10
Leucine 5 10
Methionine 1 2
Asparagine 3 6
Proline 3 6
Glutamine 1 2
Arginine 0 0
Serine 4 8
Threonine 3 6
Valine 3 6
Tryptophan 0 0
Tyrosine 3 6