Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 0 1
Sequence
Reactive Loop      Linker
KACPLYCLDVEYMTCQSSGEKKLNPKCNCCLAPKNCTLHLVDGNSL
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-27 CPLYC 3 - 7 Chymotrypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46
K A C P L Y C L D V E Y M T C Q S S G E K K L N P K C N C C L A P K N C T L H L V D G N S L


Amino Acid Count Percentage
Alanine 2 4.347826087
Cysteine 7 15.2173913
Aspartic acid 2 4.347826087
Glutamic acid 2 4.347826087
Phenylalanine 0 0
Glycine 2 4.347826087
Histidine 1 2.173913043
Isoleucine 0 0
Lysine 5 10.86956522
Leucine 7 15.2173913
Methionine 1 2.173913043
Asparagine 4 8.695652174
Proline 3 6.52173913
Glutamine 1 2.173913043
Arginine 0 0
Serine 3 6.52173913
Threonine 2 4.347826087
Valine 2 4.347826087
Tryptophan 0 0
Tyrosine 2 4.347826087