Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
IACPLYCLQVEYMTCRSSGEEKLPPKCNCCLAPKNCTLHLSDSTSIHCN
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-27 CPLYC 3 - 7 Chymotrypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 30
Bond 2 7 - 15
Bond 3 27 - 36
Bond 4 29 - 48
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49
I A C P L Y C L Q V E Y M T C R S S G E E K L P P K C N C C L A P K N C T L H L S D S T S I H C N


Amino Acid Count Percentage
Alanine 2 4.081632653
Cysteine 8 16.32653061
Aspartic acid 1 2.040816327
Glutamic acid 3 6.12244898
Phenylalanine 0 0
Glycine 1 2.040816327
Histidine 2 4.081632653
Isoleucine 2 4.081632653
Lysine 3 6.12244898
Leucine 6 12.24489796
Methionine 1 2.040816327
Asparagine 3 6.12244898
Proline 4 8.163265306
Glutamine 1 2.040816327
Arginine 1 2.040816327
Serine 5 10.20408163
Threonine 3 6.12244898
Valine 1 2.040816327
Tryptophan 0 0
Tyrosine 2 4.081632653