Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
KACTRNCDPDVAYMVCPSSGHRIIKQVCVNCCSARKGCKLFRKNGSVKCIG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-30 CTRNC 3 - 7 Trypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 28
Bond 2 7 - 32
Bond 3 16 - 38
Bond 4 31 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C T R N C D P D V A Y M V C P S S G H R I I K Q V C V N C C S A R K G C K L F R K N G S V K C I G


Amino Acid Count Percentage
Alanine 3 5.882352941
Cysteine 8 15.68627451
Aspartic acid 2 3.921568627
Glutamic acid 0 0
Phenylalanine 1 1.960784314
Glycine 4 7.843137255
Histidine 1 1.960784314
Isoleucine 3 5.882352941
Lysine 6 11.76470588
Leucine 1 1.960784314
Methionine 1 1.960784314
Asparagine 3 5.882352941
Proline 2 3.921568627
Glutamine 1 1.960784314
Arginine 4 7.843137255
Serine 4 7.843137255
Threonine 1 1.960784314
Valine 5 9.803921569
Tryptophan 0 0
Tyrosine 1 1.960784314