Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 4 4 2
Sequence
Reactive Loop      Linker
KICPQYCTDQAGYMTCPSSGNTQLSPSCNCCLAPAGCTLYRADGTSICTG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-33 CPQYC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 28
Bond 2 7 - 31
Bond 3 16 - 37
Bond 4 30 - 48
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K I C P Q Y C T D Q A G Y M T C P S S G N T Q L S P S C N C C L A P A G C T L Y R A D G T S I C T G


Amino Acid Count Percentage
Alanine 4 8
Cysteine 8 16
Aspartic acid 2 4
Glutamic acid 0 0
Phenylalanine 0 0
Glycine 5 10
Histidine 0 0
Isoleucine 2 4
Lysine 1 2
Leucine 3 6
Methionine 1 2
Asparagine 2 4
Proline 4 8
Glutamine 3 6
Arginine 1 2
Serine 5 10
Threonine 6 12
Valine 0 0
Tryptophan 0 0
Tyrosine 3 6