Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 2 4 1
Sequence
Reactive Loop      Linker
FACPQYCLEVDYVTCPSSGAEKLPARCNCCMTPKGCTLHISDGTQQTC
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-33 CPQYC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 27
Bond 2 7 - 15
Bond 3 29 - 48
Bond 4 30 - 36
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48
F A C P Q Y C L E V D Y V T C P S S G A E K L P A R C N C C M T P K G C T L H I S D G T Q Q T C


Amino Acid Count Percentage
Alanine 3 6.25
Cysteine 8 16.66666667
Aspartic acid 2 4.166666667
Glutamic acid 2 4.166666667
Phenylalanine 1 2.083333333
Glycine 3 6.25
Histidine 1 2.083333333
Isoleucine 1 2.083333333
Lysine 2 4.166666667
Leucine 3 6.25
Methionine 1 2.083333333
Asparagine 1 2.083333333
Proline 4 8.333333333
Glutamine 3 6.25
Arginine 1 2.083333333
Serine 3 6.25
Threonine 5 10.41666667
Valine 2 4.166666667
Tryptophan 0 0
Tyrosine 2 4.166666667