Domain Type No. Of PIs No. of DS Bonds No. of Species
L-H Type (Type-II) 2 4 1
Sequence
Reactive Loop      Linker
MCLQVCDDEVAYMTCPSSGDEQISPVCVNCCTAGEGCKLFRADGSLICTG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-36 CLQVC 2 - 6 Unknown
Linkers
Entry Linker Position Type
L-56 GDEQI 19 - 23 Type-II(EEKKN)
Disulphide Bonds
Bond No. Position
Bond 1 2 - 31
Bond 2 6 - 37
Bond 3 15 - 27
Bond 4 30 - 48
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
M C L Q V C D D E V A Y M T C P S S G D E Q I S P V C V N C C T A G E G C K L F R A D G S L I C T G


Amino Acid Count Percentage
Alanine 3 6
Cysteine 8 16
Aspartic acid 4 8
Glutamic acid 3 6
Phenylalanine 1 2
Glycine 5 10
Histidine 0 0
Isoleucine 2 4
Lysine 1 2
Leucine 3 6
Methionine 2 4
Asparagine 1 2
Proline 2 4
Glutamine 2 4
Arginine 1 2
Serine 4 8
Threonine 3 6
Valine 4 8
Tryptophan 0 0
Tyrosine 1 2