Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 2 4 2
Sequence
Reactive Loop      Linker
KSCLQFCDNEVAYMTCPSSRDEQISPVCVNCCTANEGCKLFRKNGSLICTG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-37 CLQFC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 28
Bond 2 7 - 32
Bond 3 16 - 38
Bond 4 31 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K S C L Q F C D N E V A Y M T C P S S R D E Q I S P V C V N C C T A N E G C K L F R K N G S L I C T G


Amino Acid Count Percentage
Alanine 2 3.921568627
Cysteine 8 15.68627451
Aspartic acid 2 3.921568627
Glutamic acid 3 5.882352941
Phenylalanine 2 3.921568627
Glycine 3 5.882352941
Histidine 0 0
Isoleucine 2 3.921568627
Lysine 3 5.882352941
Leucine 3 5.882352941
Methionine 1 1.960784314
Asparagine 4 7.843137255
Proline 2 3.921568627
Glutamine 2 3.921568627
Arginine 2 3.921568627
Serine 5 9.803921569
Threonine 3 5.882352941
Valine 3 5.882352941
Tryptophan 0 0
Tyrosine 1 1.960784314