Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
KMCIQVCDPEVASMTCPSSGDEKINDVCVNCCTAAVGCKLFRSDGSLICIG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-38 CIQVC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 32
Bond 2 7 - 38
Bond 3 16 - 28
Bond 4 31 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K M C I Q V C D P E V A S M T C P S S G D E K I N D V C V N C C T A A V G C K L F R S D G S L I C I G


Amino Acid Count Percentage
Alanine 3 5.882352941
Cysteine 8 15.68627451
Aspartic acid 4 7.843137255
Glutamic acid 2 3.921568627
Phenylalanine 1 1.960784314
Glycine 4 7.843137255
Histidine 0 0
Isoleucine 4 7.843137255
Lysine 3 5.882352941
Leucine 2 3.921568627
Methionine 2 3.921568627
Asparagine 2 3.921568627
Proline 2 3.921568627
Glutamine 1 1.960784314
Arginine 1 1.960784314
Serine 5 9.803921569
Threonine 2 3.921568627
Valine 5 9.803921569
Tryptophan 0 0
Tyrosine 0 0