Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 3 4 3
Sequence
Reactive Loop      Linker
KICPQICFDAAAYMMCPSSGTQKLAPTCNCCLAPQGCSLYYADRTLICTS
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-40 CPQIC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 28
Bond 2 7 - 31
Bond 3 16 - 37
Bond 4 30 - 48
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K I C P Q I C F D A A A Y M M C P S S G T Q K L A P T C N C C L A P Q G C S L Y Y A D R T L I C T S


Amino Acid Count Percentage
Alanine 6 12
Cysteine 8 16
Aspartic acid 2 4
Glutamic acid 0 0
Phenylalanine 1 2
Glycine 2 4
Histidine 0 0
Isoleucine 3 6
Lysine 2 4
Leucine 4 8
Methionine 2 4
Asparagine 1 2
Proline 4 8
Glutamine 3 6
Arginine 1 2
Serine 4 8
Threonine 4 8
Valine 0 0
Tryptophan 0 0
Tyrosine 3 6