Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
RVCAMYCLNGTYMTCPPKDPEKLPPACNCCLAKKRGCTIYLSDGGALYCMG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-44 CAMYC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 30
Bond 2 7 - 15
Bond 3 27 - 37
Bond 4 29 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
R V C A M Y C L N G T Y M T C P P K D P E K L P P A C N C C L A K K R G C T I Y L S D G G A L Y C M G


Amino Acid Count Percentage
Alanine 4 7.843137255
Cysteine 8 15.68627451
Aspartic acid 2 3.921568627
Glutamic acid 1 1.960784314
Phenylalanine 0 0
Glycine 5 9.803921569
Histidine 0 0
Isoleucine 1 1.960784314
Lysine 4 7.843137255
Leucine 5 9.803921569
Methionine 3 5.882352941
Asparagine 2 3.921568627
Proline 5 9.803921569
Glutamine 0 0
Arginine 2 3.921568627
Serine 1 1.960784314
Threonine 3 5.882352941
Valine 1 1.960784314
Tryptophan 0 0
Tyrosine 4 7.843137255