Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 2 0 2
Sequence
Reactive Loop      Linker
RVCAMYCLNGTYMTCPPKDPEKLPPACNCCLAKKRGCTIYLSDGGAVSG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-44 CAMYC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49
R V C A M Y C L N G T Y M T C P P K D P E K L P P A C N C C L A K K R G C T I Y L S D G G A V S G


Amino Acid Count Percentage
Alanine 4 8.163265306
Cysteine 7 14.28571429
Aspartic acid 2 4.081632653
Glutamic acid 1 2.040816327
Phenylalanine 0 0
Glycine 5 10.20408163
Histidine 0 0
Isoleucine 1 2.040816327
Lysine 4 8.163265306
Leucine 4 8.163265306
Methionine 2 4.081632653
Asparagine 2 4.081632653
Proline 5 10.20408163
Glutamine 0 0
Arginine 2 4.081632653
Serine 2 4.081632653
Threonine 3 6.12244898
Valine 2 4.081632653
Tryptophan 0 0
Tyrosine 3 6.12244898