Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
KVCPFFCYAEVAYMTCPPAPYKKLGPVCNCCLAKPGCKLFRADGTVICTA
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-53 CPFFC 3 - 7 Chymotrypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 28
Bond 2 7 - 31
Bond 3 16 - 37
Bond 4 30 - 48
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K V C P F F C Y A E V A Y M T C P P A P Y K K L G P V C N C C L A K P G C K L F R A D G T V I C T A


Amino Acid Count Percentage
Alanine 6 12
Cysteine 8 16
Aspartic acid 1 2
Glutamic acid 1 2
Phenylalanine 3 6
Glycine 3 6
Histidine 0 0
Isoleucine 1 2
Lysine 5 10
Leucine 3 6
Methionine 1 2
Asparagine 1 2
Proline 6 12
Glutamine 0 0
Arginine 1 2
Serine 0 0
Threonine 3 6
Valine 4 8
Tryptophan 0 0
Tyrosine 3 6