Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 3 1
Sequence
Reactive Loop      Linker
KYCTQDCLPNVWYMTCPSSGNKKLYPLCINCCRTPKGCKLFGPNDYLIL
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-54 CTQDC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 32
Bond 2 7 - 28
Bond 3 16 - 38
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49
K Y C T Q D C L P N V W Y M T C P S S G N K K L Y P L C I N C C R T P K G C K L F G P N D Y L I L


Amino Acid Count Percentage
Alanine 0 0
Cysteine 7 14.28571429
Aspartic acid 2 4.081632653
Glutamic acid 0 0
Phenylalanine 1 2.040816327
Glycine 3 6.12244898
Histidine 0 0
Isoleucine 2 4.081632653
Lysine 5 10.20408163
Leucine 6 12.24489796
Methionine 1 2.040816327
Asparagine 4 8.163265306
Proline 5 10.20408163
Glutamine 1 2.040816327
Arginine 1 2.040816327
Serine 2 4.081632653
Threonine 3 6.12244898
Valine 1 2.040816327
Tryptophan 1 2.040816327
Tyrosine 4 8.163265306