Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 3 4 2
Sequence
Reactive Loop      Linker
KICPQFCEPNIGYMTCPSTGHKKLYPKCINCCKAGKGCKLYRKNGSLRCTG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-12 CPQFC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 28
Bond 2 7 - 32
Bond 3 16 - 38
Bond 4 31 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K I C P Q F C E P N I G Y M T C P S T G H K K L Y P K C I N C C K A G K G C K L Y R K N G S L R C T G


Amino Acid Count Percentage
Alanine 1 1.960784314
Cysteine 8 15.68627451
Aspartic acid 0 0
Glutamic acid 1 1.960784314
Phenylalanine 1 1.960784314
Glycine 6 11.76470588
Histidine 1 1.960784314
Isoleucine 3 5.882352941
Lysine 8 15.68627451
Leucine 3 5.882352941
Methionine 1 1.960784314
Asparagine 3 5.882352941
Proline 4 7.843137255
Glutamine 1 1.960784314
Arginine 2 3.921568627
Serine 2 3.921568627
Threonine 3 5.882352941
Valine 0 0
Tryptophan 0 0
Tyrosine 3 5.882352941