Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 2 1
Sequence
Reactive Loop      Linker
QICPQFCEPNVDYMTCSSSGSTILRPTCINCSQARGRGCQLFRRDGSAICN
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-12 CPQFC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 7 - 39
Bond 2 16 - 50
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
Q I C P Q F C E P N V D Y M T C S S S G S T I L R P T C I N C S Q A R G R G C Q L F R R D G S A I C N


Amino Acid Count Percentage
Alanine 2 3.921568627
Cysteine 7 13.7254902
Aspartic acid 2 3.921568627
Glutamic acid 1 1.960784314
Phenylalanine 2 3.921568627
Glycine 4 7.843137255
Histidine 0 0
Isoleucine 4 7.843137255
Lysine 0 0
Leucine 2 3.921568627
Methionine 1 1.960784314
Asparagine 3 5.882352941
Proline 3 5.882352941
Glutamine 4 7.843137255
Arginine 5 9.803921569
Serine 6 11.76470588
Threonine 3 5.882352941
Valine 1 1.960784314
Tryptophan 0 0
Tyrosine 1 1.960784314