Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
KICPQFCYDSVAYMTCPSSGDQHLTPKCNCCLASTGCILYEADGTPICTA
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-12 CPQFC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 28
Bond 2 7 - 31
Bond 3 16 - 37
Bond 4 30 - 48
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K I C P Q F C Y D S V A Y M T C P S S G D Q H L T P K C N C C L A S T G C I L Y E A D G T P I C T A


Amino Acid Count Percentage
Alanine 4 8
Cysteine 8 16
Aspartic acid 3 6
Glutamic acid 1 2
Phenylalanine 1 2
Glycine 3 6
Histidine 1 2
Isoleucine 3 6
Lysine 2 4
Leucine 3 6
Methionine 1 2
Asparagine 1 2
Proline 4 8
Glutamine 2 4
Arginine 0 0
Serine 4 8
Threonine 5 10
Valine 1 2
Tryptophan 0 0
Tyrosine 3 6