Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
KICPQFCFDGIEYMTCPSTGDKHLKPACNCCIADEKGCAIYLNNGQVVNCT
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-12 CPQFC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 28
Bond 2 7 - 31
Bond 3 16 - 38
Bond 4 30 - 50
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K I C P Q F C F D G I E Y M T C P S T G D K H L K P A C N C C I A D E K G C A I Y L N N G Q V V N C T


Amino Acid Count Percentage
Alanine 3 5.882352941
Cysteine 8 15.68627451
Aspartic acid 3 5.882352941
Glutamic acid 2 3.921568627
Phenylalanine 2 3.921568627
Glycine 4 7.843137255
Histidine 1 1.960784314
Isoleucine 4 7.843137255
Lysine 4 7.843137255
Leucine 2 3.921568627
Methionine 1 1.960784314
Asparagine 4 7.843137255
Proline 3 5.882352941
Glutamine 2 3.921568627
Arginine 0 0
Serine 1 1.960784314
Threonine 3 5.882352941
Valine 2 3.921568627
Tryptophan 0 0
Tyrosine 2 3.921568627