Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
KICPQFCYDGIEYMTCPSTGSQRLKPVCNCCLADENGCAIYLNNGQVVNC
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-12 CPQFC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 28
Bond 2 7 - 31
Bond 3 16 - 38
Bond 4 30 - 50
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K I C P Q F C Y D G I E Y M T C P S T G S Q R L K P V C N C C L A D E N G C A I Y L N N G Q V V N C


Amino Acid Count Percentage
Alanine 2 4
Cysteine 8 16
Aspartic acid 2 4
Glutamic acid 2 4
Phenylalanine 1 2
Glycine 4 8
Histidine 0 0
Isoleucine 3 6
Lysine 2 4
Leucine 3 6
Methionine 1 2
Asparagine 5 10
Proline 3 6
Glutamine 3 6
Arginine 1 2
Serine 2 4
Threonine 2 4
Valine 3 6
Tryptophan 0 0
Tyrosine 3 6