Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
EACPQFCYEAAYMTCPSSGSTHISPSCNCCLAPQVGCKIYYSDGTLICT
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-12 CPQFC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 27
Bond 2 7 - 15
Bond 3 29 - 48
Bond 4 30 - 37
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49
E A C P Q F C Y E A A Y M T C P S S G S T H I S P S C N C C L A P Q V G C K I Y Y S D G T L I C T


Amino Acid Count Percentage
Alanine 4 8.163265306
Cysteine 8 16.32653061
Aspartic acid 1 2.040816327
Glutamic acid 2 4.081632653
Phenylalanine 1 2.040816327
Glycine 3 6.12244898
Histidine 1 2.040816327
Isoleucine 3 6.12244898
Lysine 1 2.040816327
Leucine 2 4.081632653
Methionine 1 2.040816327
Asparagine 1 2.040816327
Proline 4 8.163265306
Glutamine 2 4.081632653
Arginine 0 0
Serine 6 12.24489796
Threonine 4 8.163265306
Valine 1 2.040816327
Tryptophan 0 0
Tyrosine 4 8.163265306