Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
KICPQFCYDNLDYMTCRSTGDQKRTPSCNCCLAPTNDGCILYFANGDAPIVC
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-12 CPQFC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 30
Bond 2 7 - 31
Bond 3 16 - 28
Bond 4 39 - 52
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
K I C P Q F C Y D N L D Y M T C R S T G D Q K R T P S C N C C L A P T N D G C I L Y F A N G D A P I V C


Amino Acid Count Percentage
Alanine 3 5.769230769
Cysteine 8 15.38461538
Aspartic acid 5 9.615384615
Glutamic acid 0 0
Phenylalanine 2 3.846153846
Glycine 3 5.769230769
Histidine 0 0
Isoleucine 3 5.769230769
Lysine 2 3.846153846
Leucine 3 5.769230769
Methionine 1 1.923076923
Asparagine 4 7.692307692
Proline 4 7.692307692
Glutamine 2 3.846153846
Arginine 2 3.846153846
Serine 2 3.846153846
Threonine 4 7.692307692
Valine 1 1.923076923
Tryptophan 0 0
Tyrosine 3 5.769230769