Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
VVCPLYCLQVDYMTCPSSGSEKLPAKCNCCLARAPKGCTLHLSDGTQQTCS
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-27 CPLYC 3 - 7 Chymotrypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 27
Bond 2 7 - 15
Bond 3 29 - 50
Bond 4 30 - 38
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
V V C P L Y C L Q V D Y M T C P S S G S E K L P A K C N C C L A R A P K G C T L H L S D G T Q Q T C S


Amino Acid Count Percentage
Alanine 3 5.882352941
Cysteine 8 15.68627451
Aspartic acid 2 3.921568627
Glutamic acid 1 1.960784314
Phenylalanine 0 0
Glycine 3 5.882352941
Histidine 1 1.960784314
Isoleucine 0 0
Lysine 3 5.882352941
Leucine 6 11.76470588
Methionine 1 1.960784314
Asparagine 1 1.960784314
Proline 4 7.843137255
Glutamine 3 5.882352941
Arginine 1 1.960784314
Serine 5 9.803921569
Threonine 4 7.843137255
Valine 3 5.882352941
Tryptophan 0 0
Tyrosine 2 3.921568627