Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 3 4 3
Sequence
Reactive Loop      Linker
VACHQYCLEVDYITCPSSGSEKLPARCNCCMAGKGCTLHLSGGINQTCN
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-59 CHQYC 3 - 7 Unknown
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 27
Bond 2 7 - 30
Bond 3 15 - 36
Bond 4 29 - 48
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49
V A C H Q Y C L E V D Y I T C P S S G S E K L P A R C N C C M A G K G C T L H L S G G I N Q T C N


Amino Acid Count Percentage
Alanine 3 6.12244898
Cysteine 8 16.32653061
Aspartic acid 1 2.040816327
Glutamic acid 2 4.081632653
Phenylalanine 0 0
Glycine 5 10.20408163
Histidine 2 4.081632653
Isoleucine 2 4.081632653
Lysine 2 4.081632653
Leucine 4 8.163265306
Methionine 1 2.040816327
Asparagine 3 6.12244898
Proline 2 4.081632653
Glutamine 2 4.081632653
Arginine 1 2.040816327
Serine 4 8.163265306
Threonine 3 6.12244898
Valine 2 4.081632653
Tryptophan 0 0
Tyrosine 2 4.081632653