Domain Type No. Of PIs No. of DS Bonds No. of Species
L-H Type (Type-II) 2 4 1
Sequence
Reactive Loop      Linker
KACPFNCDPRIAYGVCPRLEEDKNNQICTNCCAGTKGCNYFSADGTFICKG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-5 CPFNC 3 - 7 Chymotrypsin
Linkers
Entry Linker Position Type
L-50 EEDKN 20 - 24 Type-II(EEKKN)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 28
Bond 2 7 - 32
Bond 3 16 - 38
Bond 4 31 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K A C P F N C D P R I A Y G V C P R L E E D K N N Q I C T N C C A G T K G C N Y F S A D G T F I C K G


Amino Acid Count Percentage
Alanine 4 7.843137255
Cysteine 8 15.68627451
Aspartic acid 3 5.882352941
Glutamic acid 2 3.921568627
Phenylalanine 3 5.882352941
Glycine 5 9.803921569
Histidine 0 0
Isoleucine 3 5.882352941
Lysine 4 7.843137255
Leucine 1 1.960784314
Methionine 0 0
Asparagine 5 9.803921569
Proline 3 5.882352941
Glutamine 1 1.960784314
Arginine 2 3.921568627
Serine 1 1.960784314
Threonine 3 5.882352941
Valine 1 1.960784314
Tryptophan 0 0
Tyrosine 2 3.921568627