Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
KVCPFNCDGRISYSVCGNKKSSGRICTNCCAARKGCNYFSADGTFVCKG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-5 CPFNC 3 - 7 Chymotrypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 26
Bond 2 7 - 30
Bond 3 16 - 36
Bond 4 29 - 47
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49
K V C P F N C D G R I S Y S V C G N K K S S G R I C T N C C A A R K G C N Y F S A D G T F V C K G


Amino Acid Count Percentage
Alanine 3 6.12244898
Cysteine 8 16.32653061
Aspartic acid 2 4.081632653
Glutamic acid 0 0
Phenylalanine 3 6.12244898
Glycine 6 12.24489796
Histidine 0 0
Isoleucine 2 4.081632653
Lysine 5 10.20408163
Leucine 0 0
Methionine 0 0
Asparagine 4 8.163265306
Proline 1 2.040816327
Glutamine 0 0
Arginine 3 6.12244898
Serine 5 10.20408163
Threonine 2 4.081632653
Valine 3 6.12244898
Tryptophan 0 0
Tyrosine 2 4.081632653