Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 4 1
Sequence
Reactive Loop      Linker
KVCPFNCNPRIAYSICPGNKRSKGRICTNCCAGKKGCNYFSTDGTFVCEG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-5 CPFNC 3 - 7 Chymotrypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 30
Bond 2 7 - 31
Bond 3 16 - 27
Bond 4 37 - 48
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K V C P F N C N P R I A Y S I C P G N K R S K G R I C T N C C A G K K G C N Y F S T D G T F V C E G


Amino Acid Count Percentage
Alanine 2 4
Cysteine 8 16
Aspartic acid 1 2
Glutamic acid 1 2
Phenylalanine 3 6
Glycine 6 12
Histidine 0 0
Isoleucine 3 6
Lysine 5 10
Leucine 0 0
Methionine 0 0
Asparagine 5 10
Proline 3 6
Glutamine 0 0
Arginine 3 6
Serine 3 6
Threonine 3 6
Valine 2 4
Tryptophan 0 0
Tyrosine 2 4