Domain Type No. Of PIs No. of DS Bonds No. of Species
L-H Type (Type-II) 1 4 1
Sequence
Reactive Loop      Linker
KPCTKECGHLGFGICPRSQGSPQNPICTNCCSGFKGCNYYSADGTFICEG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-10 CTKEC 3 - 7 Trypsin
Linkers
Entry Linker Position Type
L-54 QGSPQ 19 - 23 Type-II(EEKKN)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 31
Bond 2 7 - 37
Bond 3 15 - 27
Bond 4 30 - 48
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K P C T K E C G H L G F G I C P R S Q G S P Q N P I C T N C C S G F K G C N Y Y S A D G T F I C E G


Amino Acid Count Percentage
Alanine 1 2
Cysteine 8 16
Aspartic acid 1 2
Glutamic acid 2 4
Phenylalanine 3 6
Glycine 8 16
Histidine 1 2
Isoleucine 3 6
Lysine 3 6
Leucine 1 2
Methionine 0 0
Asparagine 3 6
Proline 4 8
Glutamine 2 4
Arginine 1 2
Serine 4 8
Threonine 3 6
Valine 0 0
Tryptophan 0 0
Tyrosine 2 4