Domain Type No. Of PIs No. of DS Bonds No. of Species
L-H Type (Type-II) 2 4 2
Sequence
Reactive Loop      Linker
NFCPQFCDPDIAYSKCPRSEGETIINPTGCTTCCTGYKGCYYFGQDGEFVCEG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-12 CPQFC 3 - 7 Unknown
Linkers
Entry Linker Position Type
L-78 EGETI 20 - 24 Type-II(EEKKN)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 33
Bond 2 7 - 34
Bond 3 16 - 30
Bond 4 40 - 51
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53
N F C P Q F C D P D I A Y S K C P R S E G E T I I N P T G C T T C C T G Y K G C Y Y F G Q D G E F V C E G


Amino Acid Count Percentage
Alanine 1 1.886792453
Cysteine 8 15.09433962
Aspartic acid 3 5.660377358
Glutamic acid 4 7.547169811
Phenylalanine 4 7.547169811
Glycine 7 13.20754717
Histidine 0 0
Isoleucine 3 5.660377358
Lysine 2 3.773584906
Leucine 0 0
Methionine 0 0
Asparagine 2 3.773584906
Proline 4 7.547169811
Glutamine 2 3.773584906
Arginine 1 1.886792453
Serine 2 3.773584906
Threonine 5 9.433962264
Valine 1 1.886792453
Tryptophan 0 0
Tyrosine 4 7.547169811