Domain Type No. Of PIs No. of DS Bonds No. of Species
L-H Type (Type-II) 1 4 1
Sequence
Reactive Loop      Linker
KGCTQECDPRVAYMTCPSSGLAKLNEVCVNCCTAGEGCKLYEHDGSLLCTG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-18 CTQEC 3 - 7 Unknown
Linkers
Entry Linker Position Type
L-71 GLAKL 20 - 24 Type-II(EEKKN)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 31
Bond 2 7 - 32
Bond 3 16 - 28
Bond 4 38 - 49
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51
K G C T Q E C D P R V A Y M T C P S S G L A K L N E V C V N C C T A G E G C K L Y E H D G S L L C T G


Amino Acid Count Percentage
Alanine 3 5.882352941
Cysteine 8 15.68627451
Aspartic acid 2 3.921568627
Glutamic acid 4 7.843137255
Phenylalanine 0 0
Glycine 6 11.76470588
Histidine 1 1.960784314
Isoleucine 0 0
Lysine 3 5.882352941
Leucine 5 9.803921569
Methionine 1 1.960784314
Asparagine 2 3.921568627
Proline 2 3.921568627
Glutamine 1 1.960784314
Arginine 1 1.960784314
Serine 3 5.882352941
Threonine 4 7.843137255
Valine 3 5.882352941
Tryptophan 0 0
Tyrosine 2 3.921568627