Domain Type No. Of PIs No. of DS Bonds No. of Species
L-H Type (Type-II) 1 4 1
Sequence
Reactive Loop      Linker
KICTQQCDPKVAYMICPSSGSTKLLTQICVNCCTAKADCKLYGHDGSLLCTG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-20 CTQQC 3 - 7 Unknown
Linkers
Entry Linker Position Type
L-73 GSTKL 20 - 24 Type-II(EEKKN)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 33
Bond 2 7 - 39
Bond 3 16 - 29
Bond 4 32 - 50
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52
K I C T Q Q C D P K V A Y M I C P S S G S T K L L T Q I C V N C C T A K A D C K L Y G H D G S L L C T G


Amino Acid Count Percentage
Alanine 3 5.769230769
Cysteine 8 15.38461538
Aspartic acid 3 5.769230769
Glutamic acid 0 0
Phenylalanine 0 0
Glycine 4 7.692307692
Histidine 1 1.923076923
Isoleucine 3 5.769230769
Lysine 5 9.615384615
Leucine 5 9.615384615
Methionine 1 1.923076923
Asparagine 1 1.923076923
Proline 2 3.846153846
Glutamine 3 5.769230769
Arginine 0 0
Serine 4 7.692307692
Threonine 5 9.615384615
Valine 2 3.846153846
Tryptophan 0 0
Tyrosine 2 3.846153846