Domain Type No. Of PIs No. of DS Bonds No. of Species
L-H Type (Type-II) 1 4 1
Sequence
Reactive Loop      Linker
KACTRECGHFSYGICPRSEGSPQKPICTNCCSGYKGCNYYSAKGDLICEG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-4 CTREC 3 - 7 Trypsin
Linkers
Entry Linker Position Type
L-49 EGSPQ 19 - 23 Type-II(EEKKN)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 27
Bond 2 7 - 31
Bond 3 15 - 37
Bond 4 30 - 48
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
K A C T R E C G H F S Y G I C P R S E G S P Q K P I C T N C C S G Y K G C N Y Y S A K G D L I C E G


Amino Acid Count Percentage
Alanine 2 4
Cysteine 8 16
Aspartic acid 1 2
Glutamic acid 3 6
Phenylalanine 1 2
Glycine 7 14
Histidine 1 2
Isoleucine 3 6
Lysine 4 8
Leucine 1 2
Methionine 0 0
Asparagine 2 4
Proline 3 6
Glutamine 1 2
Arginine 2 4
Serine 5 10
Threonine 2 4
Valine 0 0
Tryptophan 0 0
Tyrosine 4 8