Domain Type No. Of PIs No. of DS Bonds No. of Species
L-H Type (Type-II) 1 4 1
Sequence
Reactive Loop      Linker
MFCTMECGKFSYTICPRSEGSPRNPICINCCAGYKGCNYYSANGTFICEG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-19 CTMEC 3 - 7 Unknown
Linkers
Entry Linker Position Type
L-45 EGSPR 19 - 23 Type-II(EEKKN)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 31
Bond 2 7 - 15
Bond 3 27 - 37
Bond 4 30 - 48
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50
M F C T M E C G K F S Y T I C P R S E G S P R N P I C I N C C A G Y K G C N Y Y S A N G T F I C E G


Amino Acid Count Percentage
Alanine 2 4
Cysteine 8 16
Aspartic acid 0 0
Glutamic acid 3 6
Phenylalanine 3 6
Glycine 6 12
Histidine 0 0
Isoleucine 4 8
Lysine 2 4
Leucine 0 0
Methionine 2 4
Asparagine 4 8
Proline 3 6
Glutamine 0 0
Arginine 2 4
Serine 4 8
Threonine 3 6
Valine 0 0
Tryptophan 0 0
Tyrosine 4 8