Domain Type No. Of PIs No. of DS Bonds No. of Species
L-H Type (Type-II) 1 4 1
Sequence
Reactive Loop      Linker
KHCPRNCDPKIAYSKCPGRSEGKTIIKPTGCTTCCTGYKGCYYYGKDDKFVCEG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-1 CPRNC 3 - 7 Trypsin
Linkers
Entry Linker Position Type
L-75 EGKTI 21 - 25 Type-II(EEKKN)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 34
Bond 2 7 - 35
Bond 3 16 - 31
Bond 4 41 - 52
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54
K H C P R N C D P K I A Y S K C P G R S E G K T I I K P T G C T T C C T G Y K G C Y Y Y G K D D K F V C E G


Amino Acid Count Percentage
Alanine 1 1.851851852
Cysteine 8 14.81481481
Aspartic acid 3 5.555555556
Glutamic acid 2 3.703703704
Phenylalanine 1 1.851851852
Glycine 7 12.96296296
Histidine 1 1.851851852
Isoleucine 3 5.555555556
Lysine 8 14.81481481
Leucine 0 0
Methionine 0 0
Asparagine 1 1.851851852
Proline 4 7.407407407
Glutamine 0 0
Arginine 2 3.703703704
Serine 2 3.703703704
Threonine 5 9.259259259
Valine 1 1.851851852
Tryptophan 0 0
Tyrosine 5 9.259259259