Domain Type No. Of PIs No. of DS Bonds No. of Species
H+L Type (Type-III) 1 3 1
Sequence
Reactive Loop      Linker
NVCPRNCDTNIAYLKCLRSEGKSLVYPAGCTTCCTGYKGGYYFGKNGKFVCEG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-1 CPRNC 3 - 7 Trypsin
Linkers
Entry Linker Position Type
Disulphide Bonds
Bond No. Position
Bond 1 3 - 34
Bond 2 7 - 33
Bond 3 16 - 51
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53
N V C P R N C D T N I A Y L K C L R S E G K S L V Y P A G C T T C C T G Y K G G Y Y F G K N G K F V C E G


Amino Acid Count Percentage
Alanine 2 3.773584906
Cysteine 7 13.20754717
Aspartic acid 1 1.886792453
Glutamic acid 2 3.773584906
Phenylalanine 2 3.773584906
Glycine 8 15.09433962
Histidine 0 0
Isoleucine 1 1.886792453
Lysine 5 9.433962264
Leucine 3 5.660377358
Methionine 0 0
Asparagine 4 7.547169811
Proline 2 3.773584906
Glutamine 0 0
Arginine 2 3.773584906
Serine 2 3.773584906
Threonine 4 7.547169811
Valine 3 5.660377358
Tryptophan 0 0
Tyrosine 5 9.433962264