Domain Type No. Of PIs No. of DS Bonds No. of Species
L-H Type (Type-II) 1 4 1
Sequence
Reactive Loop      Linker
KPCPLNCDPHIAYSKCPRSGGKTFIYPTGCTTCCTGYKGCYYFGKDGKFVCEG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-2 CPLNC 3 - 7 Chymotrypsin
Linkers
Entry Linker Position Type
L-74 GGKTF 20 - 24 Type-II(EEKKN)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 33
Bond 2 7 - 34
Bond 3 16 - 30
Bond 4 40 - 51
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53
K P C P L N C D P H I A Y S K C P R S G G K T F I Y P T G C T T C C T G Y K G C Y Y F G K D G K F V C E G


Amino Acid Count Percentage
Alanine 1 1.886792453
Cysteine 8 15.09433962
Aspartic acid 2 3.773584906
Glutamic acid 1 1.886792453
Phenylalanine 3 5.660377358
Glycine 8 15.09433962
Histidine 1 1.886792453
Isoleucine 2 3.773584906
Lysine 6 11.32075472
Leucine 1 1.886792453
Methionine 0 0
Asparagine 1 1.886792453
Proline 5 9.433962264
Glutamine 0 0
Arginine 1 1.886792453
Serine 2 3.773584906
Threonine 5 9.433962264
Valine 1 1.886792453
Tryptophan 0 0
Tyrosine 5 9.433962264