Domain Type No. Of PIs No. of DS Bonds No. of Species
L-H Type (Type-II) 1 4 1
Sequence
Reactive Loop      Linker
KHCPRNCDPRIAYVICPRSEISNKIDLNGICTNCCAGKKRCNYFSADGTFICEG
REACTIVE LOOPS
Entry RCL Position Target Protease
RL-1 CPRNC 3 - 7 Trypsin
Linkers
Entry Linker Position Type
L-62 EISNK 20 - 24 Type-II(EEKKN)
Disulphide Bonds
Bond No. Position
Bond 1 3 - 31
Bond 2 7 - 35
Bond 3 16 - 41
Bond 4 34 - 52
Architecture
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54
K H C P R N C D P R I A Y V I C P R S E I S N K I D L N G I C T N C C A G K K R C N Y F S A D G T F I C E G


Amino Acid Count Percentage
Alanine 3 5.555555556
Cysteine 8 14.81481481
Aspartic acid 3 5.555555556
Glutamic acid 2 3.703703704
Phenylalanine 2 3.703703704
Glycine 4 7.407407407
Histidine 1 1.851851852
Isoleucine 6 11.11111111
Lysine 4 7.407407407
Leucine 1 1.851851852
Methionine 0 0
Asparagine 5 9.259259259
Proline 3 5.555555556
Glutamine 0 0
Arginine 4 7.407407407
Serine 3 5.555555556
Threonine 2 3.703703704
Valine 1 1.851851852
Tryptophan 0 0
Tyrosine 2 3.703703704